Protein Info for SO1397 in Shewanella oneidensis MR-1

Annotation: cytosine deaminase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF14437: MafB19-deam" amino acids 3 to 104 (102 residues), 71.2 bits, see alignment E=8.5e-24 PF00383: dCMP_cyt_deam_1" amino acids 3 to 97 (95 residues), 83.1 bits, see alignment E=1.2e-27

Best Hits

Swiss-Prot: 55% identical to FCY1_YEAST: Cytosine deaminase (FCY1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K01485, cytosine deaminase [EC: 3.5.4.1] (inferred from 100% identity to son:SO_1397)

MetaCyc: 55% identical to cytosine deaminase (Saccharomyces cerevisiae)
Cytosine deaminase. [EC: 3.5.4.1]; 3.5.4.1 [EC: 3.5.4.1]; 3.5.4.1 [EC: 3.5.4.1]

Predicted SEED Role

"Cytosine deaminase (EC 3.5.4.1)" (EC 3.5.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH34 at UniProt or InterPro

Protein Sequence (145 amino acids)

>SO1397 cytosine deaminase (NCBI ptt file) (Shewanella oneidensis MR-1)
MDEFLQAAIDEAKQGLAEGGIPIGSVLVIDGKIIARGHNKRVQQGSAVLHAEMDCLENAG
RLTAADYQKATLYSTLSPCDMCSGAILLYGIPKVVVGENVTFQGPEAYVQSRGVDVTVVD
NPECKQLMRDFIAAKPQLWNEDIGE