Protein Info for SO1396 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 113 to 144 (32 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 208 to 234 (27 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 274 to 297 (24 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details PF04235: DUF418" amino acids 233 to 385 (153 residues), 130.8 bits, see alignment E=2.3e-42

Best Hits

KEGG orthology group: K07148, uncharacterized protein (inferred from 100% identity to son:SO_1396)

Predicted SEED Role

"Putative xanthosine permease" in subsystem Xanthosine utilization (xap region)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH35 at UniProt or InterPro

Protein Sequence (399 amino acids)

>SO1396 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKILANNQPVCNAPHQPIPSTRNANLDAIRGLAVLGIFFMNIYFMGISFYGYAPHQIPLL
WDQILQTFSNFFIEGRFISLFSMLFGVGLYIQYQKFTAKGLAAYPLLRSRLKWLIIFGLI
HGILIWSGDILLTYGISGFLALCYRDITIAEQKRKANIFIFMSLVITCLLALSGSDELFT
RESAFFAEQYSAWTSSYPNQLLLHLIQVGYTALALPFTLMWFTAGLMLLGMALYRQGIFE
QGFNRNTLLKLALASLVLSTMDTLLGLTQNPMLVMFSDIIVMLSAIPMALIYIHILVSIC
QNRSTVLKPLQNVGKLAFSLYILQSIVGVLVFRHLAPELLLSLDRWGYMAIALVYSVVQL
LLASLYLRYFKQGPLEKLWRHLAFKKYAASLERQQASKY