Protein Info for SO1387 in Shewanella oneidensis MR-1

Annotation: HD domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 111 to 128 (18 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 164 to 189 (26 residues), see Phobius details PF20969: MASE11" amino acids 25 to 192 (168 residues), 177.6 bits, see alignment E=3e-56 PF01966: HD" amino acids 223 to 357 (135 residues), 52.7 bits, see alignment E=7.5e-18 PF13487: HD_5" amino acids 248 to 389 (142 residues), 103.5 bits, see alignment E=1.7e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1387)

Predicted SEED Role

"Response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH43 at UniProt or InterPro

Protein Sequence (422 amino acids)

>SO1387 HD domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MDCKRIFMARAEPREFTRYTSGLSHWRRLIFKRLFWFLAILCVPVYITSVYLCIVANLWG
MVIFDTIAYLFLMLLLLYTHFSDRMRFGCGCVLTYAIGVGFLIAIGPSGAGFFWLFIFPP
LSSIFLGAKASIYAQVINGISLILIGVAYHLEWLMWPVTEGYHLGIWAVVAINFLVTNAM
VTLTVAYLLGKLSSSLYSTLASRQATVLGLAKLAEYRDNETGAHLLRMRQYSKMLAAQRM
LAENPPPELDEDFIQDISLSAILHDIGKVGIADAILLKPGRLTPEEFEQIKAHPVIGGQV
LASLLEYAPRCTFITMGRDIASGHHEKWDGSGYPLGLKEENIPLSARIVALVDVYDALTS
PRCYKRPFSHEEALALILEGRAKHFDPALVDCFMQIHTEFEVLSKASLHDDPQLTVAQPK
TL