Protein Info for SO1354 in Shewanella oneidensis MR-1

Annotation: hemolysin protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 62 to 84 (23 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 129 to 154 (26 residues), see Phobius details PF01595: CNNM" amino acids 12 to 180 (169 residues), 169.9 bits, see alignment E=7e-54 PF00571: CBS" amino acids 275 to 324 (50 residues), 27.2 bits, see alignment 6.1e-10 PF03471: CorC_HlyC" amino acids 342 to 416 (75 residues), 68.9 bits, see alignment E=4.7e-23

Best Hits

Swiss-Prot: 57% identical to YFJD_ECOLI: UPF0053 inner membrane protein YfjD (yfjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to son:SO_1354)

Predicted SEED Role

"Hemolysins and related proteins containing CBS domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH75 at UniProt or InterPro

Protein Sequence (423 amino acids)

>SO1354 hemolysin protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MDAISTSALLIFLLVLILFSAYFSGSETAMMTLNRYRLRHLASNGHKGAIRALKLLERPD
RLIGLILIGNNLVNILAASIATIIGMRLWGDLGVAIASGVLTLVVLVFGEVTPKTIAALN
PERIAFPSSYLLIALSKIFAYVVTSVNFITTGILRLVGIKSISSSDALSKEELRTVVHEA
GALIPQRHQEMLLSILDLEKVTVEDIMVPRSDIYAINVNDDFKFINRQVIQSPHTRVLVY
RDTIDDAVGFIHLRDALRLQSKEQFSKSSLLRAVKELYFIPEGTPLNVQLANFQHNKERI
GLVVDEYGDIQGLVTLEDILEEIVGDFTTSMLATPSEDINVQQDGSYLVNASITIRDLNK
EMKWDFPTDGPKTLNGLILEYLEDIPSENTSLRLAGYPLEVIEVADNMVKTVRIIPQHYQ
SPH