Protein Info for SO1350 in Shewanella oneidensis MR-1

Name: recO
Annotation: DNA repair protein RecO (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF11967: RecO_N" amino acids 3 to 72 (70 residues), 50.9 bits, see alignment E=1.3e-17 TIGR00613: DNA repair protein RecO" amino acids 3 to 142 (140 residues), 71 bits, see alignment E=5.2e-24 PF02565: RecO_C" amino acids 81 to 217 (137 residues), 24.8 bits, see alignment E=1.6e-09

Best Hits

KEGG orthology group: K03584, DNA repair protein RecO (recombination protein O) (inferred from 100% identity to son:SO_1350)

Predicted SEED Role

"DNA recombination and repair protein RecO" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH79 at UniProt or InterPro

Protein Sequence (233 amino acids)

>SO1350 DNA repair protein RecO (NCBI ptt file) (Shewanella oneidensis MR-1)
MKRGYVLHHRPYRESSALVNLLVDGIGRVDAVARVGSGKRSIKSILQPFQPLIFEFSGKS
ELKNISQIEAAAPAVPLSGYSLYAGMYINELLMRTLSVQHNAEALFFIYHQALVGLAAQF
CESKLRYLELALLRELGAMPSLIRDTQGEPLIPEHCYQLVPELGFQFVLNSRAKHTYQGA
MLTALNDNQLLQEQFLEAKRLMRSMLQPLLGNKPLVSRQLFIQAAASKVDGNN