Protein Info for SO1344 in Shewanella oneidensis MR-1

Name: rseB
Annotation: sigma-E factor regulatory protein RseB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF03888: MucB_RseB" amino acids 23 to 188 (166 residues), 193.5 bits, see alignment E=2.4e-61 PF17188: MucB_RseB_C" amino acids 212 to 307 (96 residues), 93.5 bits, see alignment E=7.2e-31

Best Hits

KEGG orthology group: K03598, sigma-E factor negative regulatory protein RseB (inferred from 100% identity to son:SO_1344)

Predicted SEED Role

"Sigma factor RpoE negative regulatory protein RseB precursor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH85 at UniProt or InterPro

Protein Sequence (310 amino acids)

>SO1344 sigma-E factor regulatory protein RseB (NCBI ptt file) (Shewanella oneidensis MR-1)
MRLILLALLALVFPAVAQEDMPAKVWLEKMSQALKEKEFKASIIQLQADHIRPLVYLHGK
VNNQEVAFLEYLNGPPKNAVRVGNRVTFIEHDQPAYSILSNHIQGVWPAAFSSQMSDLEV
GYQFVMGGRTRIAGRPGQMIRLLPNDEYRYGFQIWLDMDTYLPLRYDMLTQDKQLLEQLM
VIELIEFSEPPSILQEAYKQEWPAVIDQAERQDGQNWQFSWLPAGFSVVVRDHHRLIGSH
EAVEYIALTDGLANISIYVARAGSTPLPEELITRNGLSLVAEKVGNAEVVAVGKVPTETL
ARIAKSLMLK