Protein Info for SO1314 in Shewanella oneidensis MR-1

Annotation: peptidase, M23/M37 family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 34 to 51 (18 residues), see Phobius details PF08525: OapA_N" amino acids 24 to 51 (28 residues), 36.1 bits, see alignment (E = 1.1e-12) PF04225: LysM_OapA" amino acids 127 to 193 (67 residues), 27.7 bits, see alignment E=6.2e-10 PF19425: Csd3_N2" amino acids 219 to 335 (117 residues), 66.2 bits, see alignment E=7e-22 PF01551: Peptidase_M23" amino acids 347 to 441 (95 residues), 104.3 bits, see alignment E=8.2e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1314)

Predicted SEED Role

"Peptidase, M23/M37 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHB4 at UniProt or InterPro

Protein Sequence (482 amino acids)

>SO1314 peptidase, M23/M37 family (NCBI ptt file) (Shewanella oneidensis MR-1)
MCKLTDYSGLRLSVSASMGKVITLFKLLPKKHQILLSILSVITMITLLFPSEEAQASRQT
QGVTNHQVNTRYDVPLAFRSPDRPEGIEGQTPDAPNNVTPLSSAEALAAGNHSATETLES
AHHRDVEHFDVKNGDTLAAVFERAGLTSKDVYEITQLPLAKQNLLKIIPGEEIVISKDAN
GDLTEVRYRVDAISTLVITKAQDKYSEKISEKDIEIRPKFTSAKIKSNFWNAAVDAGLNA
NQIMQLSTVFGWDIDFALDLREGDSFAIIYEQEYAEGEFLRNGNILAAEFINQDERYTAV
RYTDGNYYSENGTSMRKAFLRSPVDFKYVSSNFNPRRLHPVTGQVKAHRGVDYVAAIGTP
IKAAGNGRVIESGYSQFNGNYVFIKHNDTYTTKYLHLTKRNVNKGASVKQGQIIGTLGKT
GRVTGAHLHYEFIVNGVHRNPRTVDLPKSESIARKEKSQFDALSKQLMANISQNKQTQLA
MQ