Protein Info for SO1307 in Shewanella oneidensis MR-1

Name: aqpZ
Annotation: aquaporin Z (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details PF00230: MIP" amino acids 3 to 222 (220 residues), 180 bits, see alignment E=3e-57 TIGR00861: MIP family channel proteins" amino acids 7 to 222 (216 residues), 198.8 bits, see alignment E=5.3e-63

Best Hits

Swiss-Prot: 100% identical to AQPZ_SHEON: Aquaporin Z (aqpZ) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K06188, aquaporin Z (inferred from 100% identity to son:SO_1307)

MetaCyc: 70% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHC1 at UniProt or InterPro

Protein Sequence (229 amino acids)

>SO1307 aquaporin Z (NCBI ptt file) (Shewanella oneidensis MR-1)
MSQKMAAEFLGTLWLVLGGCGSAVLAAAFPEVGIGLLGVSLAFGLTVLTMAFAIGHISGC
HLNPAVSFGLWAGGRFPTSELLPYIIAQVAGGIAGAGVLYLIASGQEGFSLAAGFASNGF
GEHSPGGYSMISVMICEIVMTLFFLLVILGSTDERAPKGFAPIAIGLCLTLIHLISIPIS
NTSVNPARSTGPALFVGDWAVSQLWLFWAAPIIGAILAGVIYRYFNAAK