Protein Info for SO1302 in Shewanella oneidensis MR-1

Annotation: chloride channel (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 38 to 62 (25 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 175 to 204 (30 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 377 to 404 (28 residues), see Phobius details amino acids 410 to 431 (22 residues), see Phobius details PF00654: Voltage_CLC" amino acids 89 to 427 (339 residues), 261.3 bits, see alignment E=7.2e-82

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1302)

Predicted SEED Role

"Chloride channel protein EriC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHC6 at UniProt or InterPro

Protein Sequence (574 amino acids)

>SO1302 chloride channel (NCBI ptt file) (Shewanella oneidensis MR-1)
MQLTINKAAIQDAITTAKKYLTNELRDHLSQAKISAQLCLLALLFAIFASCVILLFRLLL
LWANHYTQIETLDFTGNIADWRALLPLFGALLIWFVAKLGSKRYNRMGIAYVLHRVKLHY
GKIPLQSAAGQFFQALFALGTNFSVGREGPAIHLGAVSASVLAEKFNLPDNSVRIMCASG
IAAGIAATFNAPLAAVIFVIEVIVREYKVHYFFPIMLSAICGAVSSQLVFGNVHEFDRIQ
VIHIPLDHYPILAIGGIVLGCAAAFFNYALIKVTATGQNWPLIYRLLLAGSITTLIGLIL
PQALGTGDLAISEAISEHPSLLLLIALLVAKIVATIAAIGLGIPGGLIGPLYGIGALIGA
ILALVSAILFPSIAPYVGLYTVIGMTAMMGVCLSAPLAALVALLEMTNDASIILPAMFVT
IPAFLIAYQGFKTNSIFFKQLEIMGLGYKVAPVNLALQKKGVRALMDKRFVIVNNNDELL
LEVLKRAEGRPVLVRNADGVIEMLSLEMQSFDDNVTLSRHPMQGLSDTKTLDEVYSILSP
KRSGEVFIYQDTADNVVGVISWSNLQQEIRSGQV