Protein Info for SO1286 in Shewanella oneidensis MR-1

Name: dnaG
Annotation: DNA primase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 TIGR01391: DNA primase" amino acids 3 to 413 (411 residues), 485.7 bits, see alignment E=5.6e-150 PF01807: Zn_ribbon_DnaG" amino acids 4 to 98 (95 residues), 134.2 bits, see alignment E=4.3e-43 PF08275: DNAG_N" amino acids 123 to 249 (127 residues), 147.4 bits, see alignment E=8.3e-47 PF13662: Toprim_4" amino acids 258 to 334 (77 residues), 60 bits, see alignment E=7.3e-20 PF01751: Toprim" amino acids 259 to 336 (78 residues), 61.4 bits, see alignment E=2.7e-20 PF13155: Toprim_2" amino acids 261 to 347 (87 residues), 66.6 bits, see alignment E=7.5e-22 PF10410: DnaB_bind" amino acids 368 to 416 (49 residues), 23.7 bits, see alignment 1.6e-08 PF08278: DnaG_DnaB_bind" amino acids 448 to 566 (119 residues), 95.2 bits, see alignment E=1.3e-30

Best Hits

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 100% identity to son:SO_1286)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHD9 at UniProt or InterPro

Protein Sequence (574 amino acids)

>SO1286 DNA primase (NCBI ptt file) (Shewanella oneidensis MR-1)
MAIPRDFINELIARTDIVELIDRKVPLKKAGKNYSACCPFHSEKSPSFTVSRDKQFYHCF
GCGAHGNAIDFVMEYDRLDFVDAIEDLAGQLGLEVPREQGTGKRQDDGLSRDLYQLMEEA
SRFFQTQLRQHQDKQKVIDYLAYRGLSDDIVEHFGIGFAPDGWDGLLSRYRQNQDAQDKL
LTAGMLISNDSGKRYDRFRDRLMFPIRDRRGRVIGFGGRVLGDGTPKYLNSPETPIFHKG
NELYGLYELKQRHRDPDKVLIVEGYMDVVALAQYGVDYAVASLGTSTTAEQFQLLLRSAK
EVICCYDGDRAGNEAAWRALETALPLLKPGDKVRFMFLPQSEDPDSMVRKIGKDPFEQLM
ESAITLPEFLFDTLATKFGTDKGNLAKQAFGLIEKIQDTVLQNLLLENLAHKLGMNSSDD
MKKKLGFTVKQPKPTASTGLKGRGTPLRLAIALLVQHPELGVGLSPQPALNHLQMPGIDL
LPLLLALTREHRLNSAQLLEQFRDSPHSGTLHKLAQWDHQVAEENQLEKFKQTLVWLNNQ
YIEQRYQELSLKQTHTKEEKIQLQKLISVMKGLN