Protein Info for SO1267 in Shewanella oneidensis MR-1

Updated annotation (from data): Gamma-glutamyl-gamma-aminobutyrate hydrolase (EC 3.5.1.94)
Rationale: Specifically important for utilizing Putrescine Dihydrochloride. Automated validation from mutant phenotype: the predicted function (RXN0-3942) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: hypothetical Glutamine amidotransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 6 to 224 (219 residues), 253.8 bits, E=1.6e-79
• PF00117: GATase
  • amino acids 74 to 229 (156 residues), 39.8 bits, E=4.2e-14

Best Hits

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 100% identity to son:SO_1267)

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

• superpathway of ornithine degradation (6/8 steps found)
• putrescine degradation II (3/4 steps found)
• superpathway of L-arginine and L-ornithine degradation (8/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (6/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.94

Sequence Analysis Tools

See Q8EHF5 at UniProt or InterPro

Protein Sequence (253 amino acids)

>SO1267 Gamma-glutamyl-gamma-aminobutyrate hydrolase (EC 3.5.1.94) (Shewanella oneidensis MR-1)
MSVLLPLIGVIACNQRLGSHPFNIVGEKYLLGVVNGAKGWPLVIPSLGADQPIEAILARL
DGILFTGSPSNVEPHLYAGVPSEAGTHHDPKRDATTLPLIRAAIAAGVPVLGICRGFQEM
NVAFGGSLHQKLHEVGHFIEHREDKEASLEVQYGPSHSITVEPGGVIYEAWGRNSAEVNS
VHTQGVERLGIGLRPEACAPDGLVEAFSVIDATEFALGVQWHPEWKVSDNPFYLSIFNAF
GDACRRRATTRVK