Protein Info for SO_1210 in Shewanella oneidensis MR-1

Annotation: lipoprotein NlpI (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13181: TPR_8" amino acids 73 to 105 (33 residues), 13.6 bits, see alignment 1.9e-05 amino acids 107 to 140 (34 residues), 19.8 bits, see alignment 2e-07 PF13432: TPR_16" amino acids 98 to 140 (43 residues), 22.9 bits, see alignment 3e-08

Best Hits

Swiss-Prot: 44% identical to NLPI_SALTI: Lipoprotein NlpI (nlpI) from Salmonella typhi

KEGG orthology group: K05803, lipoprotein NlpI (inferred from 100% identity to son:SO_1210)

Predicted SEED Role

"Lipoprotein nlpI precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHL0 at UniProt or InterPro

Protein Sequence (300 amino acids)

>SO_1210 lipoprotein NlpI (RefSeq) (Shewanella oneidensis MR-1)
MSLKIRTAVVAVLAGASLMLAGCATTQSPLDNQNDVEGKLVIAPVMTDYKVEVTLAKLNE
ILSAVELTNEQRARFHYDRGVIYDSVGLRLMARIDFMQALKLQPDLADAYNFLGIYYTQE
GEYDSAYEAFDGVLELAPNYDYAYLNRGIALYYGDRNDLALKDMQAFYAADDKDGYRALW
LYLIQSKDDAAGAKRQLQEQRKGLEADAWSTVIVDYYLGVKSRDQVFADAKLGLTHPKEY
AERLCEAYFYLAKMAIANKQYQEAANYFRLALATNIYDFVEHRYARIELAKVKGLLEGTK