Protein Info for SO1205 in Shewanella oneidensis MR-1

Name: rbfA
Annotation: ribosome-binding factor A (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 TIGR00082: ribosome-binding factor A" amino acids 1 to 115 (115 residues), 120.2 bits, see alignment E=3.2e-39 PF02033: RBFA" amino acids 7 to 110 (104 residues), 111.8 bits, see alignment E=9.4e-37

Best Hits

Swiss-Prot: 100% identical to RBFA_SHEON: Ribosome-binding factor A (rbfA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02834, ribosome-binding factor A (inferred from 100% identity to son:SO_1205)

Predicted SEED Role

"Ribosome-binding factor A" in subsystem NusA-TFII Cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHL4 at UniProt or InterPro

Protein Sequence (147 amino acids)

>SO1205 ribosome-binding factor A (NCBI ptt file) (Shewanella oneidensis MR-1)
MAKEFSRTRRIGQQLQQELAVVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDK
DVVQEKLNALIAAAPYIRTLVAGRMKLRVMPEIRFVYDSSLVEGMRMSNLVSQVINSDKA
KQQQFGSVDDDVIENDIEESDDTEGKV