Protein Info for SO1194 in Shewanella oneidensis MR-1

Name: secF-1
Annotation: protein-export membrane protein SecF (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 219 to 245 (27 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details PF07549: Sec_GG" amino acids 30 to 51 (22 residues), 31.9 bits, see alignment (E = 7.1e-12) TIGR00966: protein-export membrane protein SecF" amino acids 32 to 269 (238 residues), 215.5 bits, see alignment E=9.8e-68 PF02355: SecD_SecF_C" amino acids 103 to 274 (172 residues), 189.7 bits, see alignment E=3.7e-60 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 104 to 268 (165 residues), 165.4 bits, see alignment E=1.7e-52

Best Hits

KEGG orthology group: K03074, preprotein translocase subunit SecF (inferred from 100% identity to son:SO_1194)

Predicted SEED Role

"Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHM5 at UniProt or InterPro

Protein Sequence (294 amino acids)

>SO1194 protein-export membrane protein SecF (NCBI ptt file) (Shewanella oneidensis MR-1)
MKNINLTKWRYISSAISIFLMLASLTIVCVKGFNWGLDFTGGVVTEVQLDRKITSSELQP
LLNAAYQQDVSVISASEPGRWVLRYADTAQSHVDIAQTLAPLGEVQVLNTSVVGPQVGKE
LAEQGGLALLVAMLAILGYLSYRFEWRLASGALFALVHDVMFVLAFFSLTQMEFNLTVLA
AVLAILGYSLNDSIIIADRIRELLIAKPKLAIQEINNQAIVATFSRTMVTSGTTLMTVGA
LWIMGGGPLEGFSIAMFIGILTGTFSSISVGTSLPEFLGLAPEHYQVQAITDTP