Protein Info for SO1170 in Shewanella oneidensis MR-1

Annotation: iojap domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 TIGR00090: ribosome silencing factor" amino acids 7 to 104 (98 residues), 129.4 bits, see alignment E=2.3e-42 PF02410: RsfS" amino acids 10 to 104 (95 residues), 120.4 bits, see alignment E=1.6e-39

Best Hits

Swiss-Prot: 54% identical to IOJAP_SHIFL: Ribosomal silencing factor RsfS (rsfS) from Shigella flexneri

KEGG orthology group: K09710, ribosome-associated protein (inferred from 95% identity to spc:Sputcn32_2867)

Predicted SEED Role

"Ribosomal silencing factor RsfA (former Iojap)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHP7 at UniProt or InterPro

Protein Sequence (109 amino acids)

>SO1170 iojap domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MQSAELKQFVVDKIDDLKARDVVVIDVSNQSNITDYMVICSGTSKTHVKAIAENLVIEAK
AAGIPPIGIEGRDSSEWVLVDMGNVILHVMQDQTRDFYQLEKLWSEKQA