Protein Info for SO1166 in Shewanella oneidensis MR-1

Annotation: membrane-bound lytic transglycosylase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13406: SLT_2" amino acids 54 to 344 (291 residues), 312.7 bits, see alignment E=1.2e-97 TIGR02282: lytic murein transglycosylase B" amino acids 56 to 346 (291 residues), 424.3 bits, see alignment E=1.1e-131

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 100% identity to son:SO_1166)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHQ1 at UniProt or InterPro

Protein Sequence (354 amino acids)

>SO1166 membrane-bound lytic transglycosylase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MPILRAYLAPLAVLCLSSYLIGCSTANDPVNTTQPISVAVTTPAPTPVLPEALKAEFIKT
QMAQGFTKAEVETFLAKAKYNQAVIDAISRPWEAKPWHKYYPIFLTEKRLDAGLAFWKKH
EKAIAKAASNYQVEPQIIVAIIGIETFYGQYTGNYPVIDALYTLGFYYEPRATFFRKEFG
ELMKLVKEEHLDIDSLKGSYAGAMGFGQFIPSSYRHYAVDFDGSGNRDLLKSPDDAIGSV
ANYFHEHGWQLNAPVALPLVNRSANAPKAKVWAGEKLHYKVSDILSPTLSLTNARDVDAS
QKAMLIELEQVGSKDYWLGLNNFYVITRYNRSPLYSMAVYQFSQQLKQQHDAKK