Protein Info for SO1160 in Shewanella oneidensis MR-1

Name: rimI
Annotation: ribosomal-protein-alanine acetyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 22 to 154 (133 residues), 108.3 bits, see alignment E=1.6e-35 PF00583: Acetyltransf_1" amino acids 53 to 132 (80 residues), 53.7 bits, see alignment E=5e-18 PF13673: Acetyltransf_10" amino acids 58 to 138 (81 residues), 41.8 bits, see alignment E=2.1e-14 PF13508: Acetyltransf_7" amino acids 59 to 134 (76 residues), 42.7 bits, see alignment E=1.2e-14 PF08445: FR47" amino acids 77 to 134 (58 residues), 25.5 bits, see alignment E=2.1e-09

Best Hits

Swiss-Prot: 42% identical to RIMI_ECO57: [Ribosomal protein S18]-alanine N-acetyltransferase (rimI) from Escherichia coli O157:H7

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to son:SO_1160)

MetaCyc: 42% identical to protein N-acetyltransferase RimI (Escherichia coli K-12 substr. MG1655)
2.3.1.128-RXN [EC: 2.3.1.266]; 2.3.1.- [EC: 2.3.1.266]

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128 or 2.3.1.266

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHQ7 at UniProt or InterPro

Protein Sequence (162 amino acids)

>SO1160 ribosomal-protein-alanine acetyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSYQIIKKLNESLQIVLLDPSDVDQMAQIEASAHSHPMSLNNLADCFGHLYRVFGLTHTS
GQLFGFAIIQQIVDEVTLLDICLVPAEQGQGFGRLLLDAIIEDAKNAGAVVVMLEVRESN
LAARALYQNRGFVETGRRKGYYLLAEGKEDAILMDLALSETA