Protein Info for SO1149 in Shewanella oneidensis MR-1

Annotation: hypothetical SAM-dependent methyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 PF17785: PUA_3" amino acids 5 to 68 (64 residues), 75.2 bits, see alignment E=7.2e-25 PF10672: Methyltrans_SAM" amino acids 185 to 377 (193 residues), 73.3 bits, see alignment E=4.9e-24 PF03602: Cons_hypoth95" amino acids 217 to 308 (92 residues), 31.4 bits, see alignment E=3.9e-11 PF06325: PrmA" amino acids 219 to 298 (80 residues), 22.5 bits, see alignment E=1.9e-08 PF05175: MTS" amino acids 221 to 343 (123 residues), 27 bits, see alignment E=7.6e-10

Best Hits

Swiss-Prot: 100% identical to RLMI_SHEON: Ribosomal RNA large subunit methyltransferase I (rlmI) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 100% identity to son:SO_1149)

MetaCyc: 58% identical to 23S rRNA m5C1962 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11602 [EC: 2.1.1.191]

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.191

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHR8 at UniProt or InterPro

Protein Sequence (396 amino acids)

>SO1149 hypothetical SAM-dependent methyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MAIRIKLKPGREKSLERRHPWVFSNGIHNVKGKPEPGQTVDVVAHDGHWLGRGAWSGESQ
IQVRVWTFDREEEIDREFFKRRILRAQAGRDDLIREQGLTGYRLIAAESDGLPGITIDKY
ANVLVCQLLSMGADVWRDTIVDVLAELYPDCAIYERSDVDSRKKEGLASTMGLLHGTLPE
MPLIIEENGIKIAVDVTKGHKTGFYLDQRDNRAIAARFVKGKSVLNCFCYTGTFGLYAAK
AGAASIENVDVSSLALDTARLNMRVNGLSDDNVHYNEADVFKLLRQYRDEGKTFDVIVLD
PPKFADNKSQLNGACRGYKDINMIALQLLNPGGVLLTFSCSGLMPADLFQKIVADAALDA
KREIQFIERLSQASDHPIGSAFPEGFYLKGLVARVW