Protein Info for SO1139 in Shewanella oneidensis MR-1

Name: fklB
Annotation: peptidyl-prolyl cis-trans isomerase FklB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF01346: FKBP_N" amino acids 9 to 107 (99 residues), 90.3 bits, see alignment E=1.2e-29 PF00254: FKBP_C" amino acids 115 to 202 (88 residues), 96.6 bits, see alignment E=9.2e-32

Best Hits

Swiss-Prot: 57% identical to FKBB_ECOLI: FKBP-type 22 kDa peptidyl-prolyl cis-trans isomerase (fklB) from Escherichia coli (strain K12)

KEGG orthology group: K03773, FKBP-type peptidyl-prolyl cis-trans isomerase FklB [EC: 5.2.1.8] (inferred from 100% identity to son:SO_1139)

MetaCyc: 57% identical to peptidyl-prolyl cis-trans isomerase FklB (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase FklB (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHS8 at UniProt or InterPro

Protein Sequence (205 amino acids)

>SO1139 peptidyl-prolyl cis-trans isomerase FklB (NCBI ptt file) (Shewanella oneidensis MR-1)
MSDKFSTVEQQASYGVGRQMGEQLAANSFEGVDIPAVQAGLADAFAGLESAVSMQELQVA
FTEISRRIQAAQEQAAAEASAEGEAFLVENANREGVIVTESGLQYEVLVQGNGAKPTYED
TVRTHYHGSFINGDVFDSSVVRGQPAEFPVSGVIAGWTEALQLMPVGTKLKLYVPHHLAY
GERGAGASIPPYSTLVFEVELLDIV