Protein Info for SO1121 in Shewanella oneidensis MR-1

Name: proB
Annotation: glutamate 5-kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01027: glutamate 5-kinase
  • amino acids 9 to 371 (363 residues), 476 bits, E=4e-147
• PF00696: AA_kinase
  • amino acids 10 to 239 (230 residues), 156.2 bits, E=1.2e-49
• PF01472: PUA
  • amino acids 281 to 355 (75 residues), 71.8 bits, E=3.5e-24

Best Hits

Swiss-Prot: 100% identical to PROB_SHEON: Glutamate 5-kinase (proB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 100% identity to son:SO_1121)

MetaCyc: 63% identical to glutamate 5-kinase (Escherichia coli K-12 substr. MG1655)
Glutamate 5-kinase. [EC: 2.7.2.11]

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (3/3 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-N^δ-acetylornithine biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

See Q8EHU2 at UniProt or InterPro

Protein Sequence (372 amino acids)

>SO1121 glutamate 5-kinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MNLSEIAYRRVVVKLGTSVLTSGSKQLDKAHMVELARQMAALMRSGVEVVLCTSGAIAAG
REHLQYPALPDTMANKQLLAAVGQSQLILAWAQLFSIYGLHVGQLLLTRADLHDRERYLN
ARDTLNALLANNIIPIINENDAVATNEIKVGDNDNLSARAALLCDADLLILLTDQKGLFD
ADPRTNPNAKLISQVEKIDDSLRLLAGGSVSGLGTGGMSTKLEAADIARRAGIEVVIASG
HHPDVIKKVVAKESIGTHFSAIENPLESRKQWILAGPAAQGSLVLDAGAVKAVTEKGRSL
LSKGIIGVKGEFERGATLQLVDQNGKIIARGITRYCGEALGLIAGKHSDEIESVLGYDYG
DAIVHRNDMVVL