Protein Info for SO1120 in Shewanella oneidensis MR-1

Annotation: xanthine/uracil permease family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 373 to 399 (27 residues), see Phobius details amino acids 410 to 428 (19 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 17 to 392 (376 residues), 176.8 bits, see alignment E=3e-56

Best Hits

Swiss-Prot: 51% identical to ADEP_ECOLI: Adenine permease AdeP (adeP) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to son:SO_1120)

MetaCyc: 51% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHU3 at UniProt or InterPro

Protein Sequence (429 amino acids)

>SO1120 xanthine/uracil permease family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLEKLFKLKQNQTSLKQEAMAGLTTFMTMAYIIFVNPMMLADAGMDHGAVFVATCLATAV
GCIVMGLMANYPIALAPGMGLNAFFTYTVVGEMGYSWETALGAVFLSGICFLILSLVRIR
EWIVNSIPMSLRIGIAAGIGLFLALIGLKSAGIVVASPATLVTMGDITAFPAVMAVLGFF
LIIAMVQRGMKSAVILSILIITGLGLLFGDVHYNGIVSMPPSIAPTFMQMDLSQVFEVTM
LSVVFAFLFVDLFDTSGTLVAVAQRGGFLDENNRLPRLNRALTADSLATIAGAALGTSTT
TSYIESTAGVSAGGRTGLTAVVVGLLFILALFVSPLAGMIPAYATAGTLFYVAILMMSGL
VHVEWEDLTEAAPVVIVCILMPLTFSIATGIALGIISYAAIKLLTGRFSDLNIGVLVLAA
MFVAKFIYA