Protein Info for SO1106 in Shewanella oneidensis MR-1

Name: nqrD-2
Annotation: NADH:ubiquinone oxidoreductase, Na translocating, hydrophobic membrane protein NqrD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 101 to 118 (18 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details TIGR01939: NADH:ubiquinone oxidoreductase, Na(+)-translocating, D subunit" amino acids 4 to 207 (204 residues), 338.8 bits, see alignment E=6.7e-106 PF02508: Rnf-Nqr" amino acids 8 to 195 (188 residues), 204.8 bits, see alignment E=5.5e-65

Best Hits

Swiss-Prot: 100% identical to NQRD_SHEON: Na(+)-translocating NADH-quinone reductase subunit D (nqrD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00349, Na+-transporting NADH:ubiquinone oxidoreductase subunit D [EC: 1.6.5.-] (inferred from 97% identity to spc:Sputcn32_0943)

MetaCyc: 76% identical to Na(+)-translocating NADH-quinone reductase subunit D (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit D (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHV6 at UniProt or InterPro

Protein Sequence (210 amino acids)

>SO1106 NADH:ubiquinone oxidoreductase, Na translocating, hydrophobic membrane protein NqrD (NCBI ptt file) (Shewanella oneidensis MR-1)
MSDAKELKQVLTGPIVNNNPIALQVLGVCSALAVTSKLETALVMALALTAVTAFSNLFIS
MIRNHIPSSVRIIVQMTIIASLVIVVDQLLQAYAYQISKQLSVFVGLIITNCIVMGRAEA
YAMKTPPMMSFMDGIGNGLGYGAILLAVGFVRELFGNGSLFGVQILHKISDGGWYQPNGL
LLLPPSAFFLIGMLIWIIRTYKPEQVEAKG