Protein Info for SO1091 in Shewanella oneidensis MR-1

Annotation: membrane protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 211 to 228 (18 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details PF00892: EamA" amino acids 3 to 135 (133 residues), 61.6 bits, see alignment E=5e-21 amino acids 150 to 280 (131 residues), 70.1 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1091)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHW9 at UniProt or InterPro

Protein Sequence (296 amino acids)

>SO1091 membrane protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MLYLFPLLAVVIWAGNAIVNKLSFGIIAPEAIAFYRWFFAMLILTPFMLKSVWKNRRRII
PLLPKLATLASLGMVLNQSLAYFAAATTTATNMALINSLVPMISLFLAVPLLKQRLSPLV
LGGSVISLLGLVFMLSHGDIANLAIGVTEGDLLLLISAFVYALYGVLLKRWQLPISTWES
VYIQGIIAVLMLTPLLFSAPSIAISSQATPLIVYAAFGASLIAPWAWINGINKLGAERTS
IFFNLMPILAAIFAAIILNETLAIYHYLGGTMVILGVMLVQIKPKPKTTTIITCAE