Protein Info for SO1074 in Shewanella oneidensis MR-1

Annotation: tyrosine-specific transport protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 369 to 393 (25 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 2 to 387 (386 residues), 311.6 bits, see alignment E=8.9e-97 PF01490: Aa_trans" amino acids 2 to 235 (234 residues), 34.5 bits, see alignment E=9.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1074)

Predicted SEED Role

"Tyrosine-specific transport protein" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHY0 at UniProt or InterPro

Protein Sequence (395 amino acids)

>SO1074 tyrosine-specific transport protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MNSKMLGSIAIVAGTAIGAGMLALPLATAALGMVPAILLMVVIWGLSAYTSLLMLEINLR
SGVGDNVHAITGKLLGKKGQIVQGASFLSLLVALTAAYLTGGSSLLVLKAQNMFDIVLDN
QLAVVLFTIVLGGFAALGVAWVDKVSRFLFSLMILLLIVVVLFLLPEVSISTIATSAVAQ
SLTSSWMAAIPVVFTSFGFHVCIATLVRYLDGDTVSLRKVLLIGSTIPLACYIFWLLVTL
GTVGGNEINGFNGSLPALISALQEIAHTPLISKCISLFADLALITSFLGVTLSLYDFVAE
LTRAKKTFVGRAQTWLLTFVPPLLCALYVPEGFVAVLGFAAVPLVVMIIFLPIAMALRQR
QIQPQGYQVVGGTFALGLAGILGAIIIGAQLFVAL