Protein Info for SO1071 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 109 to 125 (17 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details PF01169: GDT1" amino acids 19 to 93 (75 residues), 65.6 bits, see alignment E=2.2e-22 amino acids 117 to 191 (75 residues), 83.4 bits, see alignment E=5.7e-28

Best Hits

Swiss-Prot: 54% identical to MNEA_VIBC3: Putative manganese exporter (mneA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: None (inferred from 100% identity to son:SO_1071)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHY3 at UniProt or InterPro

Protein Sequence (197 amino acids)

>SO1071 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MCLCQMPPLKGSHLEALLASTFTVAIAEIGDKTQLLALLLAARFKNKTAIILGIFLSTLF
NHFAAAWLGQWAINWVNPDVARYLVAASFFAIALWVLIPDKVDAEESRFYKMGPFVATFI
LFFIAEMGDKTQIATVVLSAKYDALAMVVAGTTIGMLLANVPVVIAGHFSAEKLPMKWIH
RGCAILFALLGVATLIY