Protein Info for SO1068 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF14539: DUF4442" amino acids 19 to 115 (97 residues), 35 bits, see alignment E=1.6e-12 TIGR00369: uncharacterized domain 1" amino acids 26 to 141 (116 residues), 118.4 bits, see alignment E=9.1e-39 PF03061: 4HBT" amino acids 57 to 134 (78 residues), 62.8 bits, see alignment E=3e-21

Best Hits

Swiss-Prot: 43% identical to Y1618_PSEAE: Putative esterase PA1618 (PA1618) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 99% identity to shn:Shewana3_0906)

MetaCyc: 43% identical to 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-9311 [EC: 3.1.2.28]

Predicted SEED Role

"ComA operon protein 2"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.28

Use Curated BLAST to search for 3.1.2.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHY6 at UniProt or InterPro

Protein Sequence (145 amino acids)

>SO1068 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSIWFRPVTLEDCARLDAGMGGKGTLMQTLGIEISEIGDDYMKATMPATPAVHNPLGIVH
GGANVALAETVASYAANFAVDFEQYYCVGQEINANHLRASRNGVLTATAKPIHVGKRSSV
WEILIHNSAGELTCISRMTAAVVKR