Protein Info for SO1060 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02722: uncharacterized lipoprotein" amino acids 3 to 188 (186 residues), 258.3 bits, see alignment E=2.5e-81 PF13036: LpoB" amino acids 42 to 186 (145 residues), 198 bits, see alignment E=3.8e-63

Best Hits

KEGG orthology group: K07337, hypothetical protein (inferred from 98% identity to sbn:Sbal195_3601)

Predicted SEED Role

"Lipoprotein YcfM, part of a salvage pathway of unknown substrate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHZ4 at UniProt or InterPro

Protein Sequence (197 amino acids)

>SO1060 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKQFKLIFVLAAVMGLAACQSKVEYGDATEVETVNENFGSTDLQAIAAKMVDSMMTFPPI
VAITANNRPILFVDSIKNKTSEHIDTESVTDSISNKLLRSGKFRFIDMTKVDSVRKQLDY
QNNTGMVDPSTAIKFGRQIGAQYMLYGNLSSIVKQDGSTKDVYYKMTMRLMDLETGLIEW
SDEKEIRKTKSKSFLGM