Protein Info for SO1052 in Shewanella oneidensis MR-1

Name: pit
Annotation: low-affinity inorganic phosphate transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 50 to 80 (31 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 155 to 181 (27 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 413 to 440 (28 residues), see Phobius details amino acids 462 to 485 (24 residues), see Phobius details PF01384: PHO4" amino acids 30 to 477 (448 residues), 300 bits, see alignment E=1.1e-93

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 100% identity to son:SO_1052)

Predicted SEED Role

"Low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI01 at UniProt or InterPro

Protein Sequence (489 amino acids)

>SO1052 low-affinity inorganic phosphate transporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MFEIFTSIGLGWSVALVLAVLFVLAYEFINGFHDTANAVATVIYTKAMPANLAVVSSALF
NFAGVLLGGLGVAYAIVHLLPVDSLLGMDSTQGLLMVFSLLFSAIIWNLGTWYFGIPASS
SHTLIGSIMGVGGAFAWIHNQPILHGINLTKATQIMLSLIISPTLGFVLAGIFLLLMKFI
WAKHKIHRTPDEQFQINGKRHPPFWARVSLIASAMGVSFAHGSNDGQKGIGLVMLVLICM
APAYFALDMSTQSYDLARTQDANRRIMAIYSRNQAVISDLVDVKAKVDASDTLLSHCSAQ
TVLPAMSSLDRRLEQVNSFQDMTIEERREVRRLLLCIDDTARKVAKLELPAKELSSLAKW
RKDLTKPTEYAPLWVIVAIATALGCGTLVGWRRIVYTVGEKIGSSGMTYSQGIAAQVTAA
VSIGIASVTGMPVSTTHILSSAVAGTMVANRSGLQSQTIKQILLAWVLTLPITMLLSACV
FILANTLWG