Protein Info for SO1051 in Shewanella oneidensis MR-1

Annotation: periplasmic glucan biosynthesis protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF04349: MdoG" amino acids 103 to 580 (478 residues), 680.5 bits, see alignment E=7.5e-209

Best Hits

Swiss-Prot: 100% identical to OPGD_SHEON: Probable glucans biosynthesis protein D (opgD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03670, periplasmic glucans biosynthesis protein (inferred from 100% identity to son:SO_1051)

Predicted SEED Role

"Glucans biosynthesis protein D precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI02 at UniProt or InterPro

Protein Sequence (597 amino acids)

>SO1051 periplasmic glucan biosynthesis protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MKIEVCLSLSSTVLHRAVTAIMLTFAEKCQEVTPIQSLLMQPNLFPEQRHLNREPMVMPS
LEAPSTRSRLQRMVGSVLLTCSVLLSLSACAAGKASAPQEEEFSYAWLKGYAHTLATESY
VSHKGELPKSLQGMSWDDYQQFHFKKKAALWREDDSEFRAELFHLGLYFDTPVHIYQLEN
GKAKRIEYSPSMFDYGKSKVKGSQLPKDLGFAGFRMQFNTDWQRDVVAFLGASYFRAVGQ
EMQYGLSARGLAVDTALPKPEEFPMFTRFWLEKPQPGSNIATVYALLDSPSVTGAYRFDI
EPGERLKMKVDAAIYPRKAIERLGVAPLTSMFMVGENDRRTGYDWRQEIHDSDGLAMHTG
NGEWIWRPLGNPSNLRFNAYSDENPKGFGLLQRDRNFDHYQDDGVFYEKRPSLWIEPTGN
WGKGSVQLVEIPTLDETFDNIVAFWNPAEPIQPGQELLYSYNMYWGGIPPEQSPRARVVD
TFTGIGGVVGQKRKYYSKRFVIDFAGGSLPMLGKDAQVKAVISTSQGRVEIESARPQHAI
NGYRAMFDIVPPEDSVEPINLRVYLEVDGQPLTETWMYQWTPPPMNERELHNAGHLQ