Protein Info for SO1048 in Shewanella oneidensis MR-1

Annotation: membrane protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details PF04172: LrgB" amino acids 29 to 240 (212 residues), 225.1 bits, see alignment E=3.4e-71

Best Hits

Swiss-Prot: 31% identical to YXAC_BACSU: Uncharacterized protein YxaC (yxaC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to son:SO_1048)

Predicted SEED Role

"CidA-associated membrane protein CidB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI05 at UniProt or InterPro

Protein Sequence (244 amino acids)

>SO1048 membrane protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MSSLNLSPAAVSELVFSQTGLALISLLLTLFCYFAAKILYQRHRVWWLAPIVLAPVVITL
LVFNLDIPLPTYFEYTHWLMAMLAPATIAFALPIYRERKLIRQYPLTIAFGVIAGLLLGM
VSSWLLVKFVPLPVELSKSLLVRSVSTPFAMEATGAFGGVPELTAMMVLITGIIGMLVCE
PLFKLMHIRTSLGKGVALGASAHGAGAAKASELGQQEGVIASLTMIFIGIAMVLGAPFFA
LIFS