Protein Info for SO1047 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details PF03788: LrgA" amino acids 13 to 105 (93 residues), 84.4 bits, see alignment E=2.2e-28

Best Hits

Swiss-Prot: 36% identical to CIDA_BACCN: Holin-like protein CidA (cidA) from Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)

KEGG orthology group: K06518, holin-like protein (inferred from 100% identity to son:SO_1047)

Predicted SEED Role

"Holin-like protein CidA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI06 at UniProt or InterPro

Protein Sequence (128 amino acids)

>SO1047 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLTQIALFCLLSFACHWFATWAHSPVPGSVLGLGILLILLATKLIPENAVQLGAAWLIGE
LLLFFIPPVISVIKYEGLFEQYGVNILFTLVMGSVCVMVGTGFVVDRVFRFERQLNIKKH
ARRHAKAA