Protein Info for SO1044 in Shewanella oneidensis MR-1

Annotation: amino acid ABC transporter, periplasmic amino acid-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00497: SBP_bac_3" amino acids 28 to 240 (213 residues), 139.1 bits, see alignment E=1.2e-44 PF10613: Lig_chan-Glu_bd" amino acids 51 to 122 (72 residues), 30.2 bits, see alignment E=6.6e-11

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 100% identity to son:SO_1044)

Predicted SEED Role

"Amino acid-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI09 at UniProt or InterPro

Protein Sequence (244 amino acids)

>SO1044 amino acid ABC transporter, periplasmic amino acid-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKKSMLLGGLTLTATLLLAGCGKSEDVLVVGTNAAFPPFEYVGGQSGDEIKGFDIELAKQ
IAKDAGKTLKVENMKFDSLIVALNSGKIDFIASGMTITPERQASVNFSEPYYEATQVLLV
NKDNESIHTLDDIKDKHFAVQLGSTADMMSKKYTQKVTAFNTGFEAIMELKNGKVDLVLF
DSEPAANYLAKNPDLKLIKLDFPPEFYGFAVSKQQPELLNSINHTLKNLKENGQYQALVS
AHIK