Protein Info for SO1043 in Shewanella oneidensis MR-1

Annotation: amino acid ABC transporter, permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 157 to 157 (1 residues), see Phobius details amino acids 161 to 175 (15 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 23 to 117 (95 residues), 79.8 bits, see alignment E=8.6e-27 PF00528: BPD_transp_1" amino acids 42 to 223 (182 residues), 89.3 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 43% identical to GLNP_RICBR: Putative glutamine transport system permease protein GlnP (glnP) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 99% identity to she:Shewmr4_3054)

MetaCyc: 36% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI10 at UniProt or InterPro

Protein Sequence (226 amino acids)

>SO1043 amino acid ABC transporter, permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLEAINTSLFSPIGDDGMIGILLILNGLKVTLIVTFFAMLLGAVLGVGTTLMKMSSKWYI
RFPAELYVGVIRGTPVVVQLVILYFIVLAALDVDKITAAIIAFGLNSGAYISEIIRAGIQ
AVDKGQTEAARSLGLSQAMTMKLIILPQAIKNILPALGNEFIVLLKETAVIGFIGGVDLM
RAGEIIRSRTFEDSVPLFTCALIYLFLTYSFTFMLSKFEKRLKQSD