Protein Info for SO1039 in Shewanella oneidensis MR-1

Name: cobO
Annotation: cob(I)alamin adenosyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF12557: Co_AT_N" amino acids 9 to 32 (24 residues), 27.8 bits, see alignment (E = 1.9e-10) TIGR00708: cob(I)yrinic acid a,c-diamide adenosyltransferase" amino acids 35 to 207 (173 residues), 229 bits, see alignment E=1.6e-72 PF02572: CobA_CobO_BtuR" amino acids 38 to 207 (170 residues), 209.5 bits, see alignment E=4.3e-66

Best Hits

Swiss-Prot: 65% identical to BTUR_ECOL6: Corrinoid adenosyltransferase (btuR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 100% identity to son:SO_1039)

MetaCyc: 64% identical to cob(I)yrinic acid a,c-diamide adenosyltransferase subunit (Salmonella enterica enterica serovar Typhimurium)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]; 2.5.1.17 [EC: 2.5.1.17]; 2.5.1.17 [EC: 2.5.1.17]

Predicted SEED Role

"Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.5.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI14 at UniProt or InterPro

Protein Sequence (207 amino acids)

>SO1039 cob(I)alamin adenosyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MTTANDNNQEQLKAERHKVRQQKLKAGVDAKIAAAQDEKGILLVLTGNGKGKSTSAFGTV
ARAVGHGKKAAVVQFIKGTWECGERNLLEGAGVSFHVMGTGFTWETQDKEKDTAAALVAW
EAAEALLQDESIDCVMLDELTYMVSYHYLDVERILTALKNRPPMQHVIITGRACHRAIIE
LADTVSEVQPIKHAFEAGIKAQLGFDY