Protein Info for SO1037 in Shewanella oneidensis MR-1

Name: cobU
Annotation: cobinamide kinase/cobinamide phosphate guanylyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K02231, adenosylcobinamide kinase / adenosylcobinamide-phosphate guanylyltransferase [EC: 2.7.1.156 2.7.7.62] (inferred from 100% identity to son:SO_1037)

Predicted SEED Role

"Adenosylcobinamide-phosphate guanylyltransferase (EC 2.7.7.62)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.7.7.62)

MetaCyc Pathways

superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
adenosylcobinamide-GDP salvage from cobinamide II (5/6 steps found)
adenosylcobinamide-GDP salvage from assorted adenosylcobamides (1/2 steps found)
adenosylcobalamin biosynthesis II (aerobic) (19/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (18/36 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.156 or 2.7.7.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI16 at UniProt or InterPro

Protein Sequence (201 amino acids)

>SO1037 cobinamide kinase/cobinamide phosphate guanylyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MIHLVLGGARSGKSRYGETLVRQYTALGFDACYVATAQALDAEMASRIRLHQDGRAMDDI
DWQLVEEPLALTARLKRLAKPGRVILVDCLTLWLSNQLLAGNPADEPASTDSDFAITVAT
SSKHDALAQWRQAKAEFVGALNALEGAVILISNEVGSGIVPMGELSRQFVDEAGWLNQAV
AAVADNVTLVVAGLPLVLKSS