Protein Info for SO1018 in Shewanella oneidensis MR-1

Name: nuoE
Annotation: NADH dehydrogenase I, E subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01958: NADH-quinone oxidoreductase, E subunit
  • amino acids 36 to 179 (144 residues), 156.5 bits, E=2.7e-50
• PF01257: 2Fe-2S_thioredx
  • amino acids 37 to 179 (143 residues), 166.1 bits, E=2.4e-53

Best Hits

Swiss-Prot: 75% identical to NUOE_PSEAE: NADH-quinone oxidoreductase subunit E (nuoE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00334, NADH dehydrogenase I subunit E [EC: 1.6.5.3] (inferred from 100% identity to son:SO_1018)

MetaCyc: 75% identical to NADH-quinone oxidoreductasesubunit E (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (3/6 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

See Q8EI32 at UniProt or InterPro

Protein Sequence (180 amino acids)

>SO1018 NADH dehydrogenase I, E subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MSQQCQCQNKQTPQGQGACSSNQSDFVLSQAERDAIEHEKHHYEDPRAASIEALKIVQQA
RGWVPDGAIYAIAAELGIPASDVEGVATFYSQIFRQPVGRHIIRVCDSMVCYINGHEQLM
AGLKEVMNLAPGQTTPDGRFTLLPVCCLGNCDKGPAIMIDDDTYGGLDPITLLKTLEAYP