Protein Info for SO1013 in Shewanella oneidensis MR-1

Name: nuoJ
Annotation: NADH dehydrogenase I, J subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details PF00499: Oxidored_q3" amino acids 15 to 157 (143 residues), 123.1 bits, see alignment E=4.1e-40

Best Hits

Swiss-Prot: 64% identical to NUOJ_ECO57: NADH-quinone oxidoreductase subunit J (nuoJ) from Escherichia coli O157:H7

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 100% identity to son:SO_1013)

MetaCyc: 64% identical to NADH:quinone oxidoreductase subunit J (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI37 at UniProt or InterPro

Protein Sequence (183 amino acids)

>SO1013 NADH dehydrogenase I, J subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MELAFYASALVAVYSTLRVISTSNPMHALLNLIISLIAVAMIFFCLGAAFAGALQVIVYA
GAIMVLFVFVVMMLNLGSDQAQEKNWLTPMTWVGPGLLSLTLLGFLAHGILGVTGGQIGL
TEVSAKQVGIELFGPYVLAVELASILLLAGMVTAYHLGREDKSGEVLSVPRSASHSGQEG
GQQ