Protein Info for SO1002 in Shewanella oneidensis MR-1

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 770 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07661: MORN_2" amino acids 152 to 168 (17 residues), 10.5 bits, see alignment (E = 3.4e-05) amino acids 172 to 193 (22 residues), 14 bits, see alignment (E = 2.4e-06) amino acids 245 to 265 (21 residues), 15.8 bits, see alignment (E = 6.5e-07) amino acids 269 to 290 (22 residues), 12.2 bits, see alignment (E = 9.2e-06) amino acids 319 to 337 (19 residues), 17.8 bits, see alignment (E = 1.5e-07) amino acids 349 to 369 (21 residues), 13 bits, see alignment (E = 5.2e-06) amino acids 396 to 417 (22 residues), 14.7 bits, see alignment (E = 1.5e-06) amino acids 445 to 463 (19 residues), 14.2 bits, see alignment (E = 2.2e-06) amino acids 476 to 496 (21 residues), 10.5 bits, see alignment (E = 3.3e-05) amino acids 630 to 649 (20 residues), 10.3 bits, see alignment (E = 3.9e-05) amino acids 654 to 674 (21 residues), 17.2 bits, see alignment (E = 2.2e-07) amino acids 678 to 698 (21 residues), 13.4 bits, see alignment (E = 3.7e-06) amino acids 702 to 721 (20 residues), 19 bits, see alignment (E = 6e-08) amino acids 726 to 745 (20 residues), 13.6 bits, see alignment (E = 3.2e-06)

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1002)

Predicted SEED Role

"FIG01057005: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI48 at UniProt or InterPro

Protein Sequence (770 amino acids)

>SO1002 hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNNTPFRFISLAIAGASLTSVHVQAAQNLSSMMVEIRQQDGIPSYYNLATGMPLNGDIAI
VRDNQGYTLGQFSQGIPNGKWQVFHTNNSRIVEGNYQQGYQDGTWRLFDLDGMMTEEQQF
AKGVPVGEWKEFSATGHVTQSTVYQNGQKSQVKRFFPSGKLQAQESYLDNLRHGKWESFY
ENSTLSQSQTYANNQLTGPYLEQNPAGQVVVSGRFDADGRRQGLWETFFDDGKKASASQF
NLDKLEGEERTFYPSGELASLCQYQAGQRHGKCQQFNELGKLQVEELYLNDMLDGRQQYF
SLEGVLTSDLYYKQDMLAGVQKYFHPNGQLKELRTYHDSQQADNGQYPLHGPSERYDADG
NIIEKSSYNMGLKDGLFERYNGGKLQTAEVWKQGQRDGEFRRYHTNGQLHSLDVYVNGKL
TGRSESFYEDGSVNERGERIEGAWVGKYESFYDNGQPRELAHYARSKADNSSSYPLDGRV
SRWYYNGDLNEEGDYKEGLKQGLWIQYASGLKQKEQTFEQGKLNGDYVEYYQGRRRVTGH
YQDDQKTGLWTDYRYEDKDPTYGVIPEGNVSQKTYRKDNKRHGTREYYSFKQVVYRLETY
DNNEKTGSYAEYYPNNGQLKLSGTLDKGQQTGLWESWYEDGILASSSEFLDNQQHGTSKE
YYSNSQLKREAQYSKGLLDGELKEYHQNGKPQRVETWQKGQKEGEASYYHANGKLAEQGT
YLKDRKEGLWQQFWPNGEKRSEGSYLADRQAGDWNHFDQLGKLINTEHHG