Protein Info for SO0987 in Shewanella oneidensis MR-1

Annotation: methyl-accepting chemotaxis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 201 to 222 (22 residues), see Phobius details PF08269: dCache_2" amino acids 53 to 196 (144 residues), 101.3 bits, see alignment E=1.5e-32 PF17200: sCache_2" amino acids 76 to 188 (113 residues), 100.8 bits, see alignment E=1.8e-32 PF17201: Cache_3-Cache_2" amino acids 78 to 189 (112 residues), 50.7 bits, see alignment E=4e-17 PF00672: HAMP" amino acids 221 to 273 (53 residues), 48.8 bits, see alignment 1.8e-16 PF00015: MCPsignal" amino acids 365 to 520 (156 residues), 139.1 bits, see alignment E=3.6e-44

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to son:SO_0987)

Predicted SEED Role

"Methyl-accepting chemotaxis protein, homolog 13"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI62 at UniProt or InterPro

Protein Sequence (554 amino acids)

>SO0987 methyl-accepting chemotaxis protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSNLSLRNKLLLLSLFPLIFTLLVLITLSYYVEQESLAEEVVTFRTKLVGERKQQIKEAT
EIASGIVNYQLSLKDKGNVNQALRDIRFGSAGYFFMYDSQGKNIFHALMPNLEGQNKIDM
TDPRGTKIIVGLLDAAKRGDGNFSYYYQKPNTNEQIEKISFVMMVPGTDWMLGTGAYIDD
IEAVVEDYRQTVTEQMAEKSLMILLIALVLTGATAFVIMVAAHRMVVPIKNMADNLNDIA
KGEGDLTKRLSVKGEDEIAQLGRAFNLFVDKLQHIIGDVASATAKVKTAANAIHDQTKVM
SSQLLSHNNETDQVVTAITEMSSTASEVAQNTTQVAEATQAATGDVANAQRCVDASLEEI
AALMEQINHAAGSIKSLSEQSQKINSVLSVIGGIAEQTNLLALNAAIEAARAGEQGRGFA
VVADEVRSLASRTQASTLEINEMLSALHKLVSQAVKTMDESQQSCVRSVESSRAISESLG
SVTSAVTAINDMSTQIATAATEQSSVTEEINRNVYAIQEIVNELLHSSEHAARVSQTVSQ
EGTNLGNLVGQFKI