Protein Info for SO0976 in Shewanella oneidensis MR-1

Name: ohr
Annotation: organic hydroperoxide resistance protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 TIGR03561: peroxiredoxin, Ohr subfamily" amino acids 4 to 135 (132 residues), 173.9 bits, see alignment E=9.9e-56 PF02566: OsmC" amino acids 38 to 133 (96 residues), 62.7 bits, see alignment E=1.8e-21

Best Hits

Swiss-Prot: 47% identical to OHR_XANCH: Organic hydroperoxide resistance protein (ohr) from Xanthomonas campestris pv. phaseoli

KEGG orthology group: K04063, osmotically inducible protein OsmC (inferred from 100% identity to son:SO_0976)

Predicted SEED Role

"Organic hydroperoxide resistance protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI71 at UniProt or InterPro

Protein Sequence (141 amino acids)

>SO0976 organic hydroperoxide resistance protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKTLYETRATASAGRQGQVSTDDGLLNVALAYPKAMGGSGLATNPEQLFAAGYAACFSNA
ILHVAKIAKVAITEAPVSAVVGIGANETGGFALTVALEVSLDLPQADAQALVRHAHQVCP
YSNATRNNIDVKLSVNGTALN