Protein Info for SO0970 in Shewanella oneidensis MR-1

Annotation: fumarate reductase flavoprotein subunit precursor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF14537: Cytochrom_c3_2" amino acids 33 to 114 (82 residues), 67.9 bits, see alignment E=4.4e-22 PF01494: FAD_binding_3" amino acids 151 to 339 (189 residues), 26.4 bits, see alignment E=2.1e-09 PF12831: FAD_oxidored" amino acids 152 to 334 (183 residues), 39.6 bits, see alignment E=2.1e-13 PF00890: FAD_binding_2" amino acids 152 to 574 (423 residues), 296.3 bits, see alignment E=2.4e-91 PF01266: DAO" amino acids 152 to 342 (191 residues), 51.1 bits, see alignment E=7.9e-17 TIGR01813: flavocytochrome c" amino acids 152 to 586 (435 residues), 563 bits, see alignment E=2.1e-173 PF01134: GIDA" amino acids 152 to 346 (195 residues), 20.2 bits, see alignment E=1.4e-07 PF07992: Pyr_redox_2" amino acids 152 to 225 (74 residues), 31.2 bits, see alignment E=7.8e-11 PF13450: NAD_binding_8" amino acids 155 to 189 (35 residues), 27.5 bits, see alignment (E = 1.5e-09)

Best Hits

Swiss-Prot: 100% identical to FRDA_SHEON: Fumarate reductase flavoprotein subunit (SO_0970) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00244, fumarate reductase flavoprotein subunit [EC: 1.3.99.1] (inferred from 100% identity to son:SO_0970)

MetaCyc: 61% identical to fumarate reductase (cytochrome) (Shewanella frigidimarina)
RXN-23709 [EC: 1.3.2.4]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.2.4 or 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P83223 at UniProt or InterPro

Protein Sequence (596 amino acids)

>SO0970 fumarate reductase flavoprotein subunit precursor (NCBI ptt file) (Shewanella oneidensis MR-1)
MFTRKIQKTALAMLISGAMAGTAYAAPEVLADFHGEMGGCDSCHVSDKGGVTNDNLTHEN
GQCVSCHGDLKELAAAAPKDKVSPHKSHLIGEIACTSCHKGHEKSVAYCDACHSFGFDMP
FGGKWERKFVPVDADKAAQDKAIAAGVKETTDVVIIGSGGAGLAAAVSARDAGAKVILLE
KEPIPGGNTKLAAGGMNAAETKPQAKLGIEDKKQIMIDDTMKGGRNINDPELVKVLANNS
SDSIDWLTSMGADMTDVGRMGGASVNRSHRPTGGAGVGAHVAQVLWDNAVKRGTDIRLNS
RVVRILEDASGKVTGVLVKGEYTGYYVIKADAVVIAAGGFAKNNERVSKYDPKLKGFKAT
NHPGATGDGLDVALQAGAATRDLEYIQAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFM
NEITTRDKASAAILQQKGESAYLVFDDSIRKSLKAIEGYVHLNIVKEGKTIEELAKQIDV
PAAELAKTVTAYNGFVKSGKDAQFERPDLPRELVVAPFYALEIAPAVHHTMGGLVIDTKA
EVKSEKTGKPITGLYAAGEVTGGVHGANRLGGNAISDIVTYGRIAGASAAKFAKDN