Protein Info for SO0950 in Shewanella oneidensis MR-1

Name: xerD
Annotation: integrase/recombinase XerD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF13495: Phage_int_SAM_4" amino acids 10 to 93 (84 residues), 37.9 bits, see alignment E=2.8e-13 PF02899: Phage_int_SAM_1" amino acids 11 to 91 (81 residues), 79.1 bits, see alignment E=3.8e-26 TIGR02225: tyrosine recombinase XerD" amino acids 13 to 299 (287 residues), 390.1 bits, see alignment E=3.2e-121 PF00589: Phage_integrase" amino acids 116 to 286 (171 residues), 183.5 bits, see alignment E=4.6e-58

Best Hits

Swiss-Prot: 100% identical to XERD_SHEON: Tyrosine recombinase XerD (xerD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 100% identity to son:SO_0950)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ZAJ8 at UniProt or InterPro

Protein Sequence (300 amino acids)

>SO0950 integrase/recombinase XerD (NCBI ptt file) (Shewanella oneidensis MR-1)
MAKTYQCDPLIDAFLDDLWSSKGLSDNTLSAYRTDLRHFDRYLQSQGLRLRDVGQADVRA
YLAYRVEQQFARTSSARLLSSLRRFYNYLLQTKQISGDPMAQIESPKLSRHLPDSLSESQ
VDRLLAEPNVDDPVECRDKAMLELLYATGLRVSELVGLTMEQMSLRQGLVRIIGKGGKER
LVPMGEMAITEVEHYLTSARHELLGHIQSDVVFPSKRSQMMTRQTFWHRIKLYASRAGIE
TELSPHTLRHAFATHLLNHGADLRVVQLLLGHSDLSTTQIYTHVARARLQELHQQHHPRG