Protein Info for SO0949 in Shewanella oneidensis MR-1

Name: brnQ
Annotation: branched-chain amino acid transport system II carrier protein BrnQ (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 378 to 396 (19 residues), see Phobius details amino acids 434 to 453 (20 residues), see Phobius details PF05525: Branch_AA_trans" amino acids 5 to 452 (448 residues), 459 bits, see alignment E=8.6e-142 TIGR00796: branched-chain amino acid transport system II carrier protein" amino acids 10 to 440 (431 residues), 409 bits, see alignment E=1.1e-126

Best Hits

Swiss-Prot: 44% identical to BRAB_BACSU: Branched-chain amino acid transport system carrier protein BraB (braB) from Bacillus subtilis (strain 168)

KEGG orthology group: K03311, branched-chain amino acid:cation transporter, LIVCS family (inferred from 100% identity to son:SO_0949)

Predicted SEED Role

"Branched-chain amino acid transport system carrier protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI94 at UniProt or InterPro

Protein Sequence (462 amino acids)

>SO0949 branched-chain amino acid transport system II carrier protein BrnQ (NCBI ptt file) (Shewanella oneidensis MR-1)
MSFGDTLGLGFMTFAFFLGAGNLIFPPFAGMLAGENMLLAMLGFLITAVGLPLVGLIAVA
KAQGKVMAMLPVFAATALAIAIYIIIGPAFAAPRTGLVAYEIGAKPFIDNTTATIMLGSL
SLNLSQLIYTLGFFIVTMLLALFPGKLLDSVGKVLTPILLLLLVGLALSVLFLPASEVGV
AVGDYKNHPLTKGILEGYNTMDTLASLMFGMLIIDLLRKKGIEQPSAQTKYLIRAAFIAA
AGLAFVYVSLFFLGATAGDIAAGAKNGGEILTNYVTREFGSLGTVLLSAVVTLACLTTAV
GLVSACSEFFNELMPKLSYRFLVVALSAICALIANVGLSQLINISIPVLMAVYPVAIALV
AVTFLTEYFPRPQFAHRAALSVALLFGIFDGMKVAAKSLTGEDGRGITEFAQSFIDFVNG
MSPTLSILPLYEEGMAWLLPTLVVIVLCLIIRGSGAKTVSAA