Protein Info for SO0943 in Shewanella oneidensis MR-1

Annotation: sensory box protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 745 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details PF21623: HK_sensor_dom_bact" amino acids 87 to 292 (206 residues), 30.1 bits, see alignment E=4.2e-11 PF00989: PAS" amino acids 360 to 459 (100 residues), 28.8 bits, see alignment E=1.6e-10 PF13426: PAS_9" amino acids 363 to 461 (99 residues), 25.6 bits, see alignment E=1.8e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0943)

Predicted SEED Role

"sensory box protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIA0 at UniProt or InterPro

Protein Sequence (745 amino acids)

>SO0943 sensory box protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MLKNNPSLQPLASLLSLAQGLHWSHQRMLAVASQLSMLVIGMIILTHLIITLGERRLQEE
WATQRYSELQTIGTLITDKVAFQQFRTQLFAKDELLNQYLKNPTPASQQKLQESWQELVQ
HIPELLGIALFDPQGNYKFATPANFSQDALPAALLGSSRNLGGKEVFTSPLEFVPLNGIL
EPYMYQMTWLERPDQSSMGYLITYNSMVQMLEAIKPAFSSNKSPMLVLDTQGLLYAGVSE
LAPLPHIPDTLGASLRQSYPALWREMSMSNFGQFHGEDATFVYLKVELTNQPELRRDYFL
LSYIRNDDIASKFSQWQNIVIVASLMLTFLAAWVILLSHMYRLQYRSRQYSIDVANTLFN
SEVGFILANEQARIISANPKAAEATQVPQDELTDRSLQRALNIDDLTHTQIVEQVHRLGE
WSGNLSLENDKGSTLKVNVRQAPKLGRGMPNMLVTLEDISEIISSQNQAFLSELLCDTTV
ATALTDANGKLIKINPVFDQLMQLNGDLNHDLASLLANDLGNQWQRITAQINMQGQWQGQ
ILSSPNLRHSNCLQATLKGHVAADGEIDYIICTLEQANDGQRGAEARNFVPHRSTILQHL
SDLERYFASLSPQSRSNSSLLVMDINPEGLLSHMSDIDQLENRQQEVEVQLLLEIPTHYQ
ILHWQLGKLLLLLPDTDATAAHHFALNTIEKLNSNGLGEGISIGIASYQEGQSLEQYLSN
AEVALKRAKQNNDQNIGQAFTRHPS