Protein Info for SO0922 in Shewanella oneidensis MR-1

Annotation: proton/glutamate symporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 5 to 6 (2 residues), see Phobius details amino acids 24 to 24 (1 residues), see Phobius details transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 208 to 234 (27 residues), see Phobius details amino acids 247 to 262 (16 residues), see Phobius details amino acids 296 to 308 (13 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details PF00375: SDF" amino acids 5 to 390 (386 residues), 480.4 bits, see alignment E=2.3e-148

Best Hits

Swiss-Prot: 40% identical to GLTT_GEOSE: Proton/sodium-glutamate symport protein (gltT) from Geobacillus stearothermophilus

KEGG orthology group: None (inferred from 100% identity to son:SO_0922)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIC1 at UniProt or InterPro

Protein Sequence (424 amino acids)

>SO0922 proton/glutamate symporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MSVPLWLQIFVGMVLGILVGVTLGEQASYLKPIGTLFVNTIKMLIVPLVFCSLIVGVTSM
EDTAKMGRIGFKSFSFYLCTTAIAISLGLVVGYVIQPGAGVPLLQHEAVNTAKEVPSVMQ
TLIDIVPTNPVAALASGQILQVIVFAVALGIALVLIGDHGKPAIKVFESLAEAMYKLTDM
VMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYIGCIIHVLGFYSIVLRLFAKLNPL
HFFKGISNAMAVAFTTSSSAGTLPASMKCASEYLGVNKKISSFVLPLGTTINMDGTALYQ
GVTALFVAQAFGIDLTWVDYLTIILTATLASIGTAGVPGAGLVMLTLVLSTVGLPLEGVA
LIAGIDRILDMARTVVNVSGDLVATTVIAKSENELDVEHYNADMVQSAVIAEQNAANESA
ATQR