Protein Info for SO0916 in Shewanella oneidensis MR-1

Annotation: transcriptional regulator, MarR family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF01047: MarR" amino acids 34 to 90 (57 residues), 36.8 bits, see alignment E=8.9e-13 PF13463: HTH_27" amino acids 34 to 99 (66 residues), 31.3 bits, see alignment E=6.2e-11 PF12802: MarR_2" amino acids 34 to 89 (56 residues), 39.6 bits, see alignment E=1.4e-13 PF00583: Acetyltransf_1" amino acids 185 to 283 (99 residues), 62.4 bits, see alignment E=1.5e-20 PF13673: Acetyltransf_10" amino acids 190 to 294 (105 residues), 33.5 bits, see alignment E=1.2e-11 PF13508: Acetyltransf_7" amino acids 199 to 284 (86 residues), 51.6 bits, see alignment E=3e-17

Best Hits

KEGG orthology group: K03828, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to son:SO_0916)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIC7 at UniProt or InterPro

Protein Sequence (309 amino acids)

>SO0916 transcriptional regulator, MarR family (NCBI ptt file) (Shewanella oneidensis MR-1)
MANDLGSSSQLRQLSRYMVRHLGMLNAAVGDLPLSPVQAHALLEIGNQPQTIKDLANKLS
IDKSNASRAIKHLIDKHLAQSQMHPRDSRCLVVQLTPAGKKLLAKLDNQQNQLFKEILAQ
LTPDQIQHIEQALMQYNQAIHKTKQQSGCIIRVASATDDAAIAQVIRDVSAEYGLTADKG
YSVADPTLDCLSQIYSQAGAQYWVVEYEGKVVGGAGIAPLANNAGICELQKMYFMPEIRG
KGLAKRLALLALDFARQTGYQSCYLETTAILKEALKLYEHLGFYPLSAPLGNTGHDACEI
PMLLPLQPE