Protein Info for SO0915 in Shewanella oneidensis MR-1

Annotation: ankyrin domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 816 PF12796: Ank_2" amino acids 33 to 109 (77 residues), 28.2 bits, see alignment E=5.9e-10 amino acids 451 to 546 (96 residues), 40.2 bits, see alignment E=1e-13 amino acids 498 to 546 (49 residues), 33.4 bits, see alignment 1.4e-11 PF13606: Ank_3" amino acids 81 to 108 (28 residues), 17.6 bits, see alignment (E = 1.1e-06) PF00023: Ank" amino acids 81 to 112 (32 residues), 20.8 bits, see alignment (E = 9.3e-08) amino acids 519 to 548 (30 residues), 31.6 bits, see alignment (E = 3.3e-11) PF13637: Ank_4" amino acids 522 to 563 (42 residues), 29.1 bits, see alignment 2.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0915)

Predicted SEED Role

"ankyrin domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIC8 at UniProt or InterPro

Protein Sequence (816 amino acids)

>SO0915 ankyrin domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLNWIFGDNNLTLREICVDNGLSTAKKIQKINKYLANGGDINFIDPDISPCNVLVPLSRS
PESDLELVDYLINNGAQIECNGFSALHSAIEFNNPELVKLYLKAGANLYYQNQFNNCWLN
YLFHPNPQYIYQDSQRIIMLDHLLELGLDINHSVSFWTNGELNHPLEILYADRSKELFLH
IINKDLYLDIAQLSLIEEIIFSSDFWGVEAFAPLVKRYPELKKSRYIMANDSSFWDDANL
LELCVYAKSQEYTEYLLDHYPQLKADSHAKSLLYAALTSEFDLRIIEKLIKATVDINRIY
RMTPPDADHSPVLNQFIDNTQFTDVNKRHYIYQALELLLKYGANPNAVFMNAGKPYEMLA
WSNLRLLVYPMVEKKTFLPEFLDLFIKYGMDINKKFGAVDEPSLLTICQRGSGKEDQATL
IQVMEYLLTKGLDLSLTNIYNTNYVSAAAIACRTQVLEWLINQGGDIFTHCGHDNSPILH
KAISTYWWDQITGPMRRNTVEILLRHGAKIEEFSVDEQFTPLMCACYYGAQSCVEVLLEH
GANPNAINAEDTTPALCAVMGGSSNEFPRFESTAVRILRLLQQYGADLTVTNSVGNSPLS
VTMEQEYKEIFEVLLQIVPYSETQLEQTLSKALPQSYFQRRLLQKLGREIPAAPTVIAHN
IAKPEVASLTSECGTTHVVAPKPAHTHKARLEVSDAAVDRSQIPTLFDLKSKVQHFFKPI
ASDPSITAQQLNSVKEQVELLIEKLDNFSFFRNQATKAEFEEGVQDYLDEMVDEINKVIE
DDYPALTEALVDSVWTILQYFRVEIEIETALRKRFW