Protein Info for SO0905 in Shewanella oneidensis MR-1

Name: nqrD-1
Annotation: NADH:ubiquinone oxidoreductase, Na translocating, hydrophobic membrane protein NqrD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 101 to 118 (18 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details TIGR01939: NADH:ubiquinone oxidoreductase, Na(+)-translocating, D subunit" amino acids 6 to 204 (199 residues), 277 bits, see alignment E=5.4e-87 PF02508: Rnf-Nqr" amino acids 10 to 195 (186 residues), 200.2 bits, see alignment E=1.4e-63

Best Hits

Swiss-Prot: 63% identical to NQRD_SHESH: Na(+)-translocating NADH-quinone reductase subunit D (nqrD) from Shewanella sediminis (strain HAW-EB3)

KEGG orthology group: K00349, Na+-transporting NADH:ubiquinone oxidoreductase subunit D [EC: 1.6.5.-] (inferred from 100% identity to she:Shewmr4_0751)

MetaCyc: 60% identical to Na(+)-translocating NADH-quinone reductase subunit D (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit D (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EID7 at UniProt or InterPro

Protein Sequence (206 amino acids)

>SO0905 NADH:ubiquinone oxidoreductase, Na translocating, hydrophobic membrane protein NqrD (NCBI ptt file) (Shewanella oneidensis MR-1)
MSNSLSMRDMLAGPVFANNPVAMQVLGVCSALAVSNSMQTAVVMTLAVTFVLVFSNLIIS
AIRNFIPNSVRIIAQMTVIASLVIIVDMVLQDVAYELSKQLSVFVGLIITNCIIMGRAEA
FAMKYPPHLAVVDAVGNAAGYGLVLISVAFVRELLGTGNLFGHSVLTTVENGGWYLPNEM
FKLPPSAFFLIGLLIWSINVIQRKRG