Protein Info for SO0904 in Shewanella oneidensis MR-1

Name: nqrC-1
Annotation: NADH:ubiquinone oxidoreductase, Na translocating, gamma subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details TIGR01938: NADH:ubiquinone oxidoreductase, Na(+)-translocating, C subunit" amino acids 6 to 248 (243 residues), 208.7 bits, see alignment E=5.7e-66 PF04205: FMN_bind" amino acids 144 to 238 (95 residues), 64.5 bits, see alignment E=5.5e-22

Best Hits

Swiss-Prot: 38% identical to NQRC_HAEDU: Na(+)-translocating NADH-quinone reductase subunit C (nqrC) from Haemophilus ducreyi (strain 35000HP / ATCC 700724)

KEGG orthology group: K00348, Na+-transporting NADH:ubiquinone oxidoreductase subunit C [EC: 1.6.5.-] (inferred from 100% identity to son:SO_0904)

MetaCyc: 38% identical to Na(+)-translocating NADH-quinone reductase subunit C (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit C (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EID8 at UniProt or InterPro

Protein Sequence (264 amino acids)

>SO0904 NADH:ubiquinone oxidoreductase, Na translocating, gamma subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MVFKKDTVVGTMIFTITLCLLCSFMITGTAGVLKERKLAKKRDELQRYVLMAADVNLGQG
NEFRDIFAKSVKPLLINLDTGKVDSDANVLDFDERMAAINPETSSTPKKDIAKIKTRAND
ARVFKVFDDSGKLSSVVVPFYGKGLWSMIYGYVAVEPDFNTIKGVVVYEHGETPGIGDFV
TDPHWLSLWKGKQLFDDKGKFAMRLVKGGVKEGDIHGVDAVSGATMTGRGVQRAMEFWFG
VEGFQTFFNQLKASADQGELGGAK