Protein Info for SO0903 in Shewanella oneidensis MR-1

Name: nqrB-1
Annotation: NADH:ubiquinone oxidoreductase, Na translocating, hydrophobic membrane protein NqrB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 58 to 78 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 153 to 183 (31 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details TIGR01937: NADH:ubiquinone oxidoreductase, Na(+)-translocating, B subunit" amino acids 26 to 404 (379 residues), 451.1 bits, see alignment E=1.8e-139 PF03116: NQR2_RnfD_RnfE" amino acids 43 to 401 (359 residues), 333 bits, see alignment E=9.3e-104

Best Hits

Swiss-Prot: 56% identical to NQRB_PSEA6: Na(+)-translocating NADH-quinone reductase subunit B (nqrB) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K00347, Na+-transporting NADH:ubiquinone oxidoreductase subunit B [EC: 1.6.5.-] (inferred from 100% identity to son:SO_0903)

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit B (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EID9 at UniProt or InterPro

Protein Sequence (410 amino acids)

>SO0903 NADH:ubiquinone oxidoreductase, Na translocating, hydrophobic membrane protein NqrB (NCBI ptt file) (Shewanella oneidensis MR-1)
MTTQPKKPDLQDATGSQEEYYATGKSMKGFVRSLVIGSGRSTKGQVHVRDAIDVKRTMTL
VGLCLLPAILFGLYNVGLQAQLALASGLSTPDTWKLALFNALSGGLTAETSVIGLFLYGL
SFYLPIYLTALLTGLFWEVVFAKVRHQELHEGFFVTALLFTLILPVSIPLWLVVMGISFG
VVIAKELFGGMGYNFLNPALAGLAFIYFAYPSEVTTVKQLVAVDGFSGATALAQAAAGQL
QFADYAWYSAFSDPNWWNNFFGFTVGAIGETSTLAVLLGGLLLLITRLADWRIVVGVMLG
MIATATLFNLIGSSTNQMMSMPWTWHLVTGGFAIAMMFMATDPVTTSYTRPGKFVYGALI
GFMTVLIRVANPKMPEGVMLAILFANLWAPLFDYLVARANIKRRLKRHGI